PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00005396001
Common NameGSBRNA2T00005396001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 295aa    MW: 32898.5 Da    PI: 5.2351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00005396001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.1e-092974346
                         SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                         +WT+eE +++ +a + + ++   +W ++a++++ g+t  +++  ++ 
  GSBRNA2T00005396001 29 KWTAEENKKFENALAFYDKDtpdRWFKVAAMLP-GKTVGDVIKQYRE 74
                         8********************************.******9999986 PP

2Myb_DNA-binding48.61.9e-15137181347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
  GSBRNA2T00005396001 137 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 181
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-42375IPR009057Homeodomain-like
PROSITE profilePS512939.6222580IPR017884SANT domain
SMARTSM007173.8E-102678IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-112882IPR009057Homeodomain-like
CDDcd001674.28E-82975No hitNo description
PfamPF002492.7E-72974IPR001005SANT/Myb domain
PROSITE profilePS5129421.845130186IPR017930Myb domain
SuperFamilySSF466891.66E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-18133185IPR006447Myb domain, plants
SMARTSM007178.7E-14134184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-13134181IPR009057Homeodomain-like
CDDcd001671.61E-11137182No hitNo description
PfamPF002497.6E-13137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MNRGIEVMSP ATYLETSPNW LFQENRETKW TAEENKKFEN ALAFYDKDTP DRWFKVAAML  60
PGKTVGDVIK QYRELEEDVS DIEAGLIPIP GYASDSFTLD WGGYDAGNMN GYYFAAVGGK  120
RGSAARAAEH ERKKGVPWTE EEHRQFLMGL KKYGKGDWRN IARNFVTTRT PTQVASHAQK  180
YFIRQVNGGK DKRRSSIHDI TTVNIPDSFD AAAADTAITN APCSPPSLGG SQREGSGQWD  240
GQTINDETAG TFYNPNAFQE TLLGMSSTPY MAKLQEQSFL NASQFESYNA YLQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1630941175RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.68660.0root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00005396001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895100.0AC189510.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB089D07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141720.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_009141719.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-94DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078FVD70.0A0A078FVD7_BRANA; BnaA04g21820D protein
STRINGBra017138.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.10.0MYB family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]